DPCstruct | MC4106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 275 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 13.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.08 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | PF14332- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3VBK0 | 2-128 | NLPSGVVVKTDVDVASVDFLGLLKELKNKVFNGYLCIAVKGKTGFEEGVMVFDNGKIEAVAYDYLAFNKSVVGSKALARVMNASSAK… |
| A0A1Q3T7N7 | 1-117 | MTAGGRSQALYGQLGIFSLNTILSALNLQKVTGRLTLAQYDQIAEIMVRDGEVVDAVYENGRGVNALLPLFSWENGVFSFIVQPADT… |
| H8H1E3 | 1-117 | None |
| K1YXR9 | 151-261 | None |
| A0A656HFC2 | 5-116 | None |
| A0LIT0 | 119-226 | None |
| A0A523E8Z2 | 314-421 | None |
| A0A7C6RWQ5 | 3-109 | None |
| A0A523DYR3 | 4-108 | None |
| A0A523DVE1 | 149-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.