DPCstruct | MC41059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817A8N2 | 2-116 | ASAKVVAEAAQAAARNESDKLDKAKVAGASADILDAAQKYGKLDEKSGAGQYLDKAEKYLNDFESSHSSGAAGTPPPAAGAPPPVSQ… |
| A0A5B7BLR1 | 1-142 | MDSIPHGKTNPTHPEKHHQQPSTSELLSSAKLMAEAAKATLNHESDKVDKAKVSGAAADLLGAASHYGKLEEKSFGKYVEKAENYLH… |
| A0A4D9BS51 | 16-143 | None |
| A0A7N2LBP2 | 16-158 | None |
| A0A6P5GF03 | 11-139 | None |
| A0A6A2YPI9 | 1-119 | None |
| A0A2P2QLN5 | 29-182 | None |
| A0A6P6VC95 | 1-133 | None |
| A0A498HLC9 | 74-196 | None |
| A0A6P6V5B6 | 17-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.