DPCstruct | MC41047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 209 ± 38 aa |
| Standard deviation of domain lengths | 38.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.91 |
| Pfam Score | 60.82 |
| Assigned Pfam label(s) | CL0229- PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397JLJ8 | 15-211 | DCSSTIKRKRFELRTVRFRHATKHDPNRIRRAKTEFMYLIGYEVINPRLRKYSVLGPTGYVHTIAISKTVSCSCPDFHLGFQCKHIY… |
| A0A6C0LYG0 | 56-268 | SLQNVLTNEFQKDIIYRSSRHYDEDRLYMIDFNLVNDPKKPNILGTFSMLGTFDFKKNTRSHYDIKMYKPNSNDKGSFWCSCPDHKF… |
| V6T9N6 | 6-222 | None |
| A0A2K1QY83 | 131-365 | None |
| A0A1X2GG39 | 48-300 | None |
| A0A6A2XZM2 | 8-218 | None |
| S4RDF5 | 107-360 | None |
| K9GY03 | 2-132 | None |
| A0A1V6S4J6 | 35-263 | None |
| A0A6S7G4P3 | 873-1098 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.