DPCstruct | MC41045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 166 ± 27 aa |
| Standard deviation of domain lengths | 27.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 46.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397JAN4 | 1-145 | MGPLGSPAFPLLLQVTSTNALESYHSELKKITSSQHGLIGACNKIIALDLKRYSDSDYVVFEFRVKKISVTGVDNDILKEIHKFPLP… |
| A0A2P4PQK1 | 258-412 | RQHSPLLLQVTSTNLLESFHSELKKITSSLHGAVHNIVNIDYKKRSEAEIASFDFRIKKISVYGVDDDILEEIKKFPFPFQQLIIKE… |
| A0A2I1EML9 | 1-120 | None |
| A0A2N0S9F6 | 1-164 | None |
| A0A397IVN3 | 35-250 | None |
| A0A397IBA5 | 56-195 | None |
| A0A433DMX0 | 101-250 | None |
| A0A2H5UEG4 | 120-284 | None |
| A0A397VIP7 | 70-260 | None |
| A0A2I1HCR4 | 116-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.