DPCstruct | MC41042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 205 ± 34 aa |
| Standard deviation of domain lengths | 34.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5WDJ6 | 72-325 | GGRGRSSRQTPAELLDVAERTGLDGEALVRCSRLSAKVDNTAVQDGFQLYLHSFVVTAEGDWAVIQQGMNPAGRMARRYHWLSSSLE… |
| A0A533UCE2 | 8-190 | ARRYYWISDYVHSTFLSKPHSGIICDKTHHNELDITARDAVETQKTSLDLVKGNPQNLISSIKKLQFCSKTMLDNWIPSDHQSQNGD… |
| A0A7C5SMP9 | 34-244 | None |
| A0A256YCY8 | 151-383 | None |
| A0A7C2QCS4 | 1-155 | None |
| A0A7C4AWP8 | 3-181 | None |
| A0A842XI20 | 2-201 | None |
| A0A2H5V0E8 | 55-272 | None |
| A0A7C1W981 | 16-200 | None |
| A0A7J2SWU1 | 183-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.