DPCstruct | MC4104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 23.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4IAF9 | 6-135 | WKLRITVLWIILAAGCSGTQILYILAPGVINNIIAGKFEGMEINTGFLIVFSLFWLIPLTMAFLTLVLKERTNRYTNAALGLFFGIY… |
| A0A7X8X8B6 | 62-189 | AMIHNITPMDPERIQLSVCWVALVLIYLLGDVLRLYEKGREAAMIDGKPMTQTHLLMAAFLMLIPILLAIGMVFLPKGIAKWSGIIG… |
| A0A317QQT0 | 2-125 | None |
| A0A2G2IY39 | 8-129 | None |
| A6F4A9 | 23-163 | None |
| A0A7X8KDR2 | 121-249 | None |
| A0A2N2MUS2 | 2-115 | None |
| A0A5P9GTN2 | 1-131 | None |
| A0A847STM0 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.