DPCstruct | MC41031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 4.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5IUM8 | 1-52 | MTDSYYTLLLGIDGACSLGDKQITYKLYDEEGKHLNPCGEIEENAYQYFMED |
| A0A7X1FIE9 | 54-101 | TDIFYSLLLGLDGAAAIGGEQHDYQLREEGGSLISGSGEIEAEAFEQF |
| A0A3G9FWK1 | 16-68 | None |
| A0A4R2SZ09 | 1-59 | None |
| A0A1G8A983 | 154-210 | None |
| A0A516WCW6 | 248-297 | None |
| A0A349YAP7 | 16-71 | None |
| A0A840F858 | 41-98 | None |
| A0A2D0NE49 | 56-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.