DPCstruct | MC4103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 270 ± 30 aa |
| Standard deviation of domain lengths | 30.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.22 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF20381- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837HSI9 | 29-317 | KPVGFVNDFAHVLPTDQAKNLEARLRSYRDATGIELAVVTVSSLDDMPIEDYASKLFAQWGIGEKGKDNGVLMLLAPTERKVRIEVG… |
| A0A1Q3SIE2 | 31-321 | VATPLAQADTGNDLAKALSNQKYYVSDGVKSNSGFMGKNSSIENDLKNEVSKLTGSKDTRIAVISNAIIPSNYGTGLSGAENYGNYL… |
| S3BKN5 | 69-394 | None |
| A0A132N6F8 | 26-271 | None |
| A0A847IEF2 | 38-317 | None |
| A0A323V5A3 | 7-300 | None |
| A0A1I4BGA8 | 2-247 | None |
| S0EXM5 | 37-314 | None |
| A0A7C3XBF0 | 133-379 | None |
| A0A1X2AD10 | 23-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.