DPCstruct | MC41023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 115 ± 20 aa |
| Standard deviation of domain lengths | 19.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5N5G2 | 2-101 | VVDQLDLLPDDMVDGLDNIVFVTEDRPEDGSLDLLGLYDGVALTERGQYGFGELPDRIILYREPHLAAVDDEEALADEIHVTLVHEI… |
| A0A7V9DFP5 | 4-77 | FEEHVRNALDSLPPHIARALENVAIVIEHENVEEPDLFGLFDWPEYMPAKISIYRKPLEAEYPDPRELEDEIAG |
| A0A6L8JG13 | 1-128 | None |
| A0A2G4FNX1 | 4-132 | None |
| A0A7C5N3S1 | 213-344 | None |
| A0A562DUY9 | 98-217 | None |
| A0A7V2UW92 | 6-126 | None |
| A0A2H0ND96 | 19-158 | None |
| E6SGU9 | 16-147 | None |
| A0A4P8TH58 | 70-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.