DPCstruct | MC41022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4FKT6 | 1-146 | MDCHLLRCKVLELIFQHNCSKPTKEPLSLTKILHFLNHVSLQLTYQDREKLWQRWDEILHQMNLLLLSYRTIVLGHLRDSVYERIRL… |
| G3H199 | 71-216 | MESHLLRCKVLEIIFLHSCETPTRLPLSLAQALYFLNNSTSLLKCQSDKSQWQTWDELVEHLQFLLSSYQHVLREHLRSSVIDRKDL… |
| A0A4U1EL61 | 1-166 | None |
| A0A6J0TJJ2 | 536-684 | None |
| A0A663FFH3 | 254-403 | None |
| A0A6P6QTQ5 | 699-836 | None |
| A0A2U9CB72 | 296-435 | None |
| A0A6P8PGT3 | 158-322 | None |
| F7D1M3 | 296-439 | None |
| A0A6P6CM37 | 760-919 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.