DPCstruct | MC4102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 68 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520XIW1 | 176-246 | EGVEATAPPAPPFEETLVGMNEAAAQEGAESFGYTWRVMQRDGEDFVGTTDYSESRINVAITDGVITRAWI |
| A0A1G2KPB6 | 9-68 | VSTKDLIGMKEKAAIAAVKRVGMVSRVMWRDGTAFMGTMDYRTDRVNLGITKGKVTGATI |
| A0A6I2X704 | 141-199 | None |
| A0A0Q7BIE3 | 1-59 | None |
| A0A2E3JEE6 | 33-107 | None |
| A0A5C6Y9Q2 | 12-73 | None |
| A0A411YCD3 | 77-154 | None |
| A0A3C1NYE2 | 238-316 | None |
| A0A060JDW0 | 146-211 | None |
| A0A5C6F8M4 | 237-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.