DPCstruct | MC41017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A387H424 | 1-118 | MPLVQDHLPFEDLPEVPTASLWCQRWNAGQHSWQHVRDGGFDARRYRVDVIPTAPAKAFVLAHHYSRSYPAATVQFGLFDVAGGQCR… |
| G2G450 | 23-123 | FTQRWRYGAPTWRHVSEGGFRAQRYAVTAIPEATAKAFVQRHHYLSGWPAVLHHPYGLLDQEAPLGAGDLAVEGLPLVGVLVLASPM… |
| U2FPQ3 | 1-85 | None |
| A0A1H7D5M2 | 1-78 | None |
| A0A431KUV2 | 8-86 | None |
| A0A2D6M6V7 | 68-143 | None |
| I4Z2A6 | 1-95 | None |
| I4YX74 | 1-86 | None |
| A0A7W3NHY2 | 22-101 | None |
| A0A7R6TAD0 | 18-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.