DPCstruct | MC41014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 87 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5TDR8 | 9-82 | KMEIIKAKIQKDLPSLCSEKLNSVATKLLDCGVEDEGDLKYVEEKDLCEILKPIHVRKLLKSWKIAVIILVIYD |
| A0A6P6Q9V2 | 4-67 | MKEVLKDAVLLVLPSLSPDVTNQLVEKLMDQGVEGLDDLVYVKEDDILEFIRPIQCRKLLSSWK |
| A0A6S7G6F6 | 247-340 | None |
| A0A060WPP3 | 4-93 | None |
| A0A3B1JNM8 | 134-199 | None |
| A0A4Y2S149 | 2-91 | None |
| A0A4Y2V8V4 | 1-128 | None |
| A0A3Q1GJG9 | 1-84 | None |
| A0A553N5J9 | 1-95 | None |
| A0A5A9PKN9 | 6-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.