DPCstruct | MC41011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 229 ± 22 aa |
| Standard deviation of domain lengths | 22.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6PJJ6 | 1-234 | MGYEYVTAVLGKNTESRNLYTERACCRRQSHVIYIGKDISGSPVNVDVGVCRTHCGQSARSASLEAGLMSTKYYESSTLDFLRYKKM… |
| A0A2G8KD85 | 50-256 | TSSRPTESSTSYTSEPMDETMGYLPTVCKRIQRNTFIGRDATGKEYLIDTGQCSHVTLTPNQSPALPQQSVEICNTTSPCDITRIRT… |
| A0A232FC19 | 25-241 | None |
| A0A7M7LPT3 | 128-341 | None |
| A0A6P8IBW0 | 8-231 | None |
| A0A834JVD9 | 8-294 | None |
| A0A1S3I604 | 3-225 | None |
| A0A315W561 | 169-403 | None |
| A0A7R9IN04 | 9-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.