DPCstruct | MC41010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 200 ± 39 aa |
| Standard deviation of domain lengths | 38.64 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6PJ52 | 8-161 | AEYLVELRDQPSLVLTNQQVSNIVALWQNLLDFDKQRVVFAARHQSRLDTGRFRSPKKRQEFTPGVESVKRHALTTTAPLAQWPDCC… |
| A0A6P6PH83 | 221-401 | PSDTGSSVSGEAQGAVIGPDGIAGWDKVQDLAGFLVGLREAPYLTNLQVTEAIQLWTALPDVDKQRVNYQPRHQPQLRHGRFKAPKR… |
| A0A6P6PSW6 | 130-284 | None |
| K1P1I5 | 342-507 | None |
| A0A6P6R7L8 | 2-281 | None |
| A0A7J6D5Q9 | 560-768 | None |
| A0A498N8U1 | 582-722 | None |
| A0A498P164 | 555-793 | None |
| A0A6P6RJM4 | 252-465 | None |
| A0A6A4VHC3 | 27-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.