DPCstruct | MC4101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Standard deviation of domain lengths | 20.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09438 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5QV06 | 77-238 | HLRVRAETDKRIAITGINPVLLDCLQNVPGIVEQRDAPNVRKRLFPPPTSSDNAANRDWENLVVPDLRHLFDSAVEIMARDLESLTA… |
| A0A2W6CZB4 | 50-206 | KRIKRLRDGSFELRLSRQERTILAGLPEQVVALLESGLTESGPLESADPDLRRLFPPAYAEDAHQEAEYRRLMGADLLASHRQALGV… |
| A0A6J6RPP2 | 1-134 | None |
| A0A1E5MFQ5 | 76-235 | None |
| A0A4R1FC47 | 6-187 | None |
| A0A5B8M0S8 | 17-174 | None |
| A0A7W1GP67 | 9-159 | None |
| A0A538MH28 | 4-130 | None |
| A0A7J9Y9J1 | 7-166 | None |
| A0A511YWB0 | 8-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.