DPCstruct | MC41006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 297 ± 49 aa |
| Standard deviation of domain lengths | 48.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 87.85 |
| Assigned Pfam label(s) | CL0488- PF04314- CL0430- CL0308 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3YFE1 | 7-243 | LRLLTWASGAWTVLAAANLIVAAPESNGVELGRLLEPGAFGPLYTFGYMPRAWTVTLFGALVLWLCSYWGTRWTTLLPGLWAGIIGA… |
| A0A6J6RV06 | 2-322 | YLSALLAAGVAFFLAFLHDQADDRWRIVPIVRIGSFLAVVGALGIVMSQAALLTGKGAGAITDTKVLRNVLTENLGWSLALLMIGLA… |
| A0A2V6QM24 | 4-319 | None |
| A0A411YBK2 | 346-625 | None |
| A0A7C2IC53 | 5-353 | None |
| A0A838H3M0 | 98-445 | None |
| A0A419HGE1 | 143-425 | None |
| D3PYY3 | 574-869 | None |
| A0A522SCN9 | 2-358 | None |
| A0A2V6IHP0 | 4-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.