DPCstruct | MC41004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 478 |
|---|---|
| Mean domain length (aa) | 80 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6RHX2 | 4-77 | ESARRIGHPAPFPVELPERLIHLYTYLNDVILDPFVGSGTTAVAAVRTGRHYVGYDTDANYVALAEARVAEERS |
| A0A7C2IWR5 | 3-62 | QYSSRAGENVIDLFGGSGSTLIACEKLGRRARLMEIDPPYCDVIIRRWQEYAGKAAKLEA |
| A0A1E1F4V3 | 39-122 | None |
| A0A1P8WNL1 | 190-273 | None |
| A0A0F9NIN1 | 176-249 | None |
| A0A1Y4H106 | 154-230 | None |
| A0A1G2Q0B2 | 18-94 | None |
| A0A1A9VKE5 | 316-388 | None |
| U1PPZ6 | 4-78 | None |
| A0A3C1F326 | 538-603 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.