DPCstruct | MC41001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 204 ± 38 aa |
| Standard deviation of domain lengths | 38.42 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835Y7B6 | 14-197 | SLTPWTFGFQCNERYLSWDQSAQLKLLKIVLADKLGVSPEEVESRTEQLARLLPDLLTRLETTRVDILQPLLADLPGLSLQLIGLKE… |
| A0A836BX88 | 1-168 | MLARQRQRVAAEIIEAGRRAGVPSSPEQLREGLQALEALLPGFTPNLDSLKASEWARIASDAPAAASKIILLKTHYPRLDLARALAA… |
| D8U1X7 | 546-790 | None |
| E1ZNJ5 | 18-240 | None |
| A0A5J4YAJ7 | 11-154 | None |
| A4S400 | 19-213 | None |
| A0A250XQW0 | 6-167 | None |
| A0A2V0PL60 | 43-308 | None |
| A0A830HX63 | 7-287 | None |
| C1E9W4 | 13-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.