DPCstruct | MC41000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835Y6S4 | 29-151 | VRLSCSSDFYDSSKRYAGLVLYGKGGSSKFELNGHRVRCGYVIIKDSSELGFSSFLDGVVHGDTFHSVFGLDELPEDLVAEGFSITG… |
| A0A7D9LRG0 | 8-174 | GGNFVLSRSKDRIMIRSWLKQTVIIETMHISCKSDTYKKRHNYGGVIIYQYDGKSEWRTANNTRCKSGYIAIQDTDSENVKKWIGKE… |
| A0A7D9EU07 | 46-222 | None |
| A0A817V4D6 | 36-187 | None |
| A0A817R290 | 29-175 | None |
| A0A819WG70 | 1-158 | None |
| A0A7D9ECE5 | 49-200 | None |
| A0A820BDB1 | 14-165 | None |
| A0A2B4RHR6 | 1-134 | None |
| A0A7J7QCK9 | 65-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.