DPCstruct | MC40993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 179 ± 31 aa |
| Standard deviation of domain lengths | 30.74 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | PF20732- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4TQG3 | 1-171 | PWIIPSPNIPTVDTCVVFPATVHLEGTELSEGRGTTKPFELNGAPYIDPSAWAEALNAFDFPGVKFRHAYFEPSFSEFAGQTCGGVQ… |
| A0A7W1W9B5 | 85-266 | KIVKVRNYRHDMEYVLPIKPSPNLNTQQSVILYPSTCLFEGTVLNHGRGTYSPFAVLGSPLLKGIYSFSFTPISIPGMSETPLHTNE… |
| A0A7X8LRC9 | 41-239 | None |
| A0A3L7MSZ0 | 557-761 | None |
| A0A2E9QD90 | 260-440 | None |
| A0A832FRA1 | 107-260 | None |
| A0A0G9L938 | 221-400 | None |
| A0A2V7KLY1 | 397-599 | None |
| I0XB76 | 256-456 | None |
| A0A7V6I3T6 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.