DPCstruct | MC40989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 4.40 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1PZH9 | 86-166 | RKDCVYSIAVHEFGHAIGFAHEQNRPDTPSDECYGRAQGTSGDTLLTPWDLHSVMNYCNPVYGNDGKLSEFDQYAVSAVYG |
| A0A7Y4SKD0 | 1-90 | MREYCIKGIAVHEFGHGLGFVHEQNRFDAPGECQQLKQGTNGDLVLTPYDPRSVMNYCNPKYNNDGMLSTLDIAAVREAYGGPPGKP… |
| A0A3A8RSW4 | 99-179 | None |
| A0A442Q5N1 | 241-321 | None |
| A0A3A8GYL9 | 76-161 | None |
| A0A1H3XMJ2 | 138-215 | None |
| A0A249PLD3 | 1-78 | None |
| A0A329D4L5 | 34-117 | None |
| B8J6V2 | 19-102 | None |
| A0A6P2KZD9 | 141-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.