DPCstruct | MC40987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF13160- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7M2Q9 | 2-145 | ILGLVHAFWSFYWAFGGTWMLDTVGQWAVVSQLERPVQTFLVLLGIGLAKTAAAVIPVAVEYGKLGGRRFWRLVSWVGGSGLVLYGG… |
| A0A4R2WMB2 | 11-185 | QTERLNAFERLTKKAVWPAYLGCFWAVMYAVFVRFYQAAGGTLGLPGQFEDPQVIYMGSYMAGVFILTCGFILIILVKPWGRVVPTW… |
| A0A364K552 | 14-173 | None |
| F6FQS2 | 272-441 | None |
| A0A223RZH5 | 39-199 | None |
| A0A2M9KTG6 | 17-154 | None |
| A0A411PQK5 | 22-186 | None |
| A0A1Q5N035 | 6-174 | None |
| A0A7M3LU18 | 10-171 | None |
| A0A1D7YNL6 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.