DPCstruct | MC40983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 303 ± 37 aa |
| Standard deviation of domain lengths | 37.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6Y8N2 | 1-340 | MNSDELEELKKLKQKIQDAVAHKKLYGVLFADSKEIELFNNCISSIKSNGIGEEESNELITIYKGLNSIFDNISSDWNGNKGSLNAQ… |
| A0A7Y6MWJ3 | 14-325 | NQGKLLKFFLDKVGEAQDMNELKQIVIKAIESGVRFNFPHQGKLYGKAYESKYSFTDYVIKKIKDISESKKDPKVASDIVCELVSRG… |
| Q4EBP3 | 288-630 | None |
| A0A225X6G3 | 30-265 | None |
| A0A3B0JF69 | 14-265 | None |
| B6Y9C1 | 6-282 | None |
| A0A482XIB0 | 4-261 | None |
| A0A1A9VZC7 | 102-380 | None |
| A0A3B0IVF1 | 109-439 | None |
| A0A5C4TMY1 | 168-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.