DPCstruct | MC40982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 524 ± 89 aa |
| Standard deviation of domain lengths | 88.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5DHN9 | 106-711 | WESLIKFVYENLDQIGISSIYFFLPIIQDWSSKNKEGGTVRYAGLIALQYYEWLIQEDKFYSHDEAKNQLLFTIIYSSSEIKDELER… |
| A0A1I1V8B8 | 22-528 | GHNHDDTSFYYEAVLVCASEDKFEIIKFANCASGVTEPTAELPLDPPPEPITDPEVLKRFEELESSSTFWDDEDEELPLIEGGSKYA… |
| A0A0N6ZTK4 | 308-881 | None |
| A7BRD4 | 2-425 | None |
| A0A0F3GJ60 | 252-843 | None |
| A0A2N5X6E0 | 5-599 | None |
| A0A6L6H8N6 | 104-662 | None |
| A0A415FFS4 | 73-644 | None |
| A0A833D587 | 14-619 | None |
| A0A0D4E235 | 1-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.