DPCstruct | MC40980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 236 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1GMN5 | 4-218 | AQDLAKLRQLSNVVNGPLRLVLVEVLELTPLVIDWINVNTSGSAVCRYQANNIRKYEVRYQFGNLGNLVHELTHVGINESYGLDFIN… |
| A0A5C4T8J0 | 102-331 | LQNEMDQLRAIMNDADTPDITKQILAEALGNADQIHLEALTPGARFTNQKEKDRGIAEKYVVNHNMNAPGGSSERLGSLAHELTHVS… |
| A0A345GY58 | 96-334 | None |
| A0A367RR75 | 37-301 | None |
| A0A1Q4VJT9 | 2-231 | None |
| A0A2T4HFY7 | 31-253 | None |
| F3NAH7 | 92-331 | None |
| A0A561IP30 | 27-274 | None |
| A0A2W2CS42 | 56-293 | None |
| A0A2N3UIG0 | 209-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.