DPCstruct | MC4098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9W5J0 | 97-198 | VGVLKIVSTPPGEAPAKMREAWVGVKIPLRRTNAKPIAVSAFGVLSRKAENLTEQAYAVPGAEAIEALVKQSPAAAVWWCHNVPEVR… |
| A0A1G2K612 | 2-111 | QCIKILGTPSGGAPKWVREAWIGLVLPLDQHWPQSNMARDVLTKTPRQIRGYNVDAVLAVEILSFRHPEAARWWRENTTLIQPGNHL… |
| A0A1F6FG48 | 1-102 | None |
| A0A0G1WFW3 | 20-130 | None |
| A0A0G0WDM3 | 48-156 | None |
| A0A2V6Q3F7 | 95-214 | None |
| A0A0L0LLV9 | 1-94 | None |
| A0A7W9SM84 | 59-145 | None |
| A0A1F4Y1E4 | 9-89 | None |
| A0A0G1AXF3 | 2-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.