DPCstruct | MC40978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 69 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832M1E6 | 4-64 | KDSPIYGMPILEVDKAHHTIVIKRGMNPGFSGVENELFYKDKTMMLFGGAKNVVEQLSAAV |
| A0A7Y5MUC9 | 89-160 | VNPAAETDPGSPIYGMPIIKANTAKNVIVMKRSMGKGYAGIENELFYDKKTRMLFGDAKASLEKLITELKSA |
| A0A7S4PET2 | 108-183 | None |
| A0A7S3FG00 | 348-424 | None |
| A0A4W5MQX0 | 715-790 | None |
| A0A3C1R245 | 41-112 | None |
| A0A7Y3L8A9 | 7-73 | None |
| A0A7C7Z4R6 | 7-57 | None |
| A0A835XZX3 | 986-1066 | None |
| A0A2E5KNV3 | 3-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.