DPCstruct | MC40971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 14.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0I9Z3 | 6-87 | EGSKGKRAAAAMTLTDIVFSWSIDDIFNDNLYKHQVDEIPERFPSVEHYLRSFVYPLLEETRAESCSSMEMIPILPYAEVTE |
| A0A2P6RFP3 | 1-72 | MGMKSKVKQEQVPETRSLVDLVFSWSIRDVLNENLYRNQVQRIPDTFVTLTSYKKSFIPSLVEETHADLLSN |
| A0A2Z6PHZ2 | 1-111 | None |
| A0A2U1MUB6 | 95-195 | None |
| A0A2U1M522 | 2-125 | None |
| A0A6S7M921 | 1-112 | None |
| A0A4Y1RYG8 | 26-133 | None |
| A0A5N5H7I1 | 2-95 | None |
| A0A0R0EH31 | 3-102 | None |
| A0A2P6RFR0 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.