DPCstruct | MC40970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 236 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 91.11 |
| Assigned Pfam label(s) | CL0123- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835HKD4 | 46-288 | TFPESCRMLMDELVSITYKYGDERTKVRALLCDIYHHAIMDGFSESRDLLLMTHLQDGVQHMDISTQILFNWAMAQLGLCAFRVGLV… |
| A0A835H4R5 | 1-223 | MLFAIYHHAINDEFSVSRDLLLMSHLQDKVQHLDASTKILFNRTMAQLGLCAFRAGLIAEAHSYLSELYADGSIKKLLCQGVSDCSC… |
| A0A7J9IPI3 | 155-388 | None |
| C5L9H5 | 58-305 | None |
| A0A376B2L8 | 523-788 | None |
| A0A7J5Z1G6 | 348-567 | None |
| A0A820XGB2 | 75-308 | None |
| D8R7V3 | 2-188 | None |
| A0A7J6P0B7 | 633-867 | None |
| A0A7J8LE24 | 100-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.