DPCstruct | MC4097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 4 aa |
| Standard deviation of domain lengths | 3.75 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351WF78 | 9-105 | KKALGRCSWCGKRIKDDMPVFGFGGRKRPGVDLTEYEGSAILISLATVPKEVICMVTATGSPAKAYGKDFMFMICSEACADEMKSVM… |
| A0A7Y5FYL0 | 6-95 | MPNRCAWCDRVIGPEEEVFGCGAKAMPGIDLSDREGKILPLFLALSRKTVPAIVVPMDSQAKKEGNDLYFVICSESCGQALKQALQM… |
| A0A321LAK6 | 22-110 | None |
| A0A1Q7JHB3 | 123-217 | None |
| A0A6N6S1U6 | 128-220 | None |
| A0A1I2JSR0 | 3-88 | None |
| A0A7C5LCL8 | 149-237 | None |
| A0A424YH56 | 3-91 | None |
| A0A2V9MNG5 | 13-109 | None |
| A0A6L8K3V8 | 3-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.