DPCstruct | MC40969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 314 ± 57 aa |
| Standard deviation of domain lengths | 56.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.50 |
| Pfam Score | 93.18 |
| Assigned Pfam label(s) | CL0020- PF09273- PF03040- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835H493 | 1-322 | MTSTLLFKRSDYIADSMPEGLRQSWYHMKRCFARFVKKGKWLMKRKDIMEELERSIEDKAERTKVVESVLGYILSSTQEAAVVPPYI… |
| A0A446YZV0 | 4-329 | GIWEYVKVHSDDLSVEGITPSEYLKFKETLYDEKWAKDDNSLEVDFGALDLSTPHLTLPSSIGNGMQFISKFMSSKLNDKPESMKPL… |
| A0A444EKI6 | 1-217 | None |
| A0A1D6P843 | 20-340 | None |
| A0A426YFH0 | 1-329 | None |
| A0A835H7Z6 | 1-288 | None |
| A0A4S4DG96 | 5-393 | None |
| A0A5N6Q4D6 | 342-739 | None |
| A0A151T3Q6 | 9-372 | None |
| A0A830CKD7 | 47-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.