DPCstruct | MC40967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 6.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 95.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4YSM7 | 319-390 | LSFRGGETAALARVQYYLWESDCVAKYKETRNGMVGGDYSSKFSAWLAHGCVSARDIYHEIKSYERTRVAND |
| A0A5C6NW95 | 217-293 | GGESQALARLKHYFWDTDAVAVYKETRNGLIGVDYSTKFSPWLALGCISPRYIYHQIKQYESERTANQSTYWVIFEL |
| A0A821EDM9 | 89-180 | None |
| A0A6M0IRV1 | 207-286 | None |
| A0A835TUE8 | 130-214 | None |
| A0A6B3MGX5 | 155-226 | None |
| A0A5N6R642 | 267-351 | None |
| A0A090PQS0 | 216-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.