DPCstruct | MC40965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 16.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835H036 | 202-280 | MVFIKPTKSRAYFKRYQVKFRRRRAGKTYYRARIRLINQDKNKYGTPKYHFVVRFTNKDIITHIVSASIVGDMILTSAY |
| A0A832S2Y7 | 6-83 | RYFVPFRRRHEGKTDYYKRMALLSSGMPRMVVRKTNRQIIVQLIVPGVGGDHTLVSAYSTELAGYGYEGSGANTPAAY |
| A0A0B7NKC9 | 1-101 | None |
| A0A2P2MT87 | 1-57 | None |
| A0A0B5HW64 | 4-78 | None |
| A0A2K6TYF4 | 1-86 | None |
| A0A7N4NWU2 | 1-91 | None |
| H0AA74 | 1-85 | None |
| A0A4S8IZ23 | 71-161 | None |
| A0A812Q4Z8 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.