DPCstruct | MC40959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2DB39 | 1-49 | MTMNQVRMQFGEPDYEHPWVGSPPITRWDYPDYSVFFEFEMVLISVVHR |
| A0A0S7ZZ98 | 5-76 | LTIPNLGGNSTRPAEDVVRPQRGMTMEEVSAQFGNPQQIKPPVGDPPITRWVYEKFTVHFEQNYVIHTVVHR |
| A0A2G2L3T5 | 41-117 | None |
| A0A352KKN0 | 52-128 | None |
| A0A370DAY1 | 78-155 | None |
| A0A0B4XMT8 | 1-78 | None |
| A0A4Q7ZAH7 | 1-84 | None |
| A0A4Q6CZR8 | 14-99 | None |
| A0A7V5PFT8 | 14-92 | None |
| A0A2P1PV92 | 6-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.