DPCstruct | MC40952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PC80 | 487-575 | LPLMILFLVNLRVFSHAAGLTEKCRAIPAFVNQIMAEEAVELNRQYLVQFIKDSSAGFYVKNVQLTQEMFAKQIYICGTVLSGLLGL… |
| A0A813BSA9 | 1-113 | WAFQNDTNEPWALVAKGCSAIPILWLLLLSLRLCSAGADLTSKCQNIPAFVNQLQSNEPLNEDRQYLVRYIDDSSAGFVIKDVKLTR… |
| A0A812VS26 | 236-325 | None |
| A0A1Q9DN71 | 135-247 | None |
| A0A7S0A290 | 23-119 | None |
| A0A1Q9EM90 | 366-452 | None |
| A0A1Q9E131 | 974-1081 | None |
| A0A812PMI7 | 1-85 | None |
| A0A812UY76 | 341-440 | None |
| A0A812L3S9 | 49-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.