DPCstruct | MC40951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 163 ± 26 aa |
| Standard deviation of domain lengths | 25.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813BPA4 | 296-447 | GFPGNLQMNGSTPGAAPGTGCYSCQTFVMSSSRGVDGKVHTERYSSSDVGNAQHGIREAQHAYSNSSTAEDKMGLERHLGERARKMV… |
| A0A150GBS2 | 3-120 | PGGMTYQASSTTRVGPGGVRETQAVVRDGRTGTESVTISRGLGDGRQRTLVRTRDVTGREEQLEDLQGITEHEAEVFDEHWRHHAER… |
| A0A7I8IG18 | 117-314 | None |
| A0A813GYM3 | 7-183 | None |
| A0A2J7RFZ5 | 43-199 | None |
| A0C566 | 67-220 | None |
| A0A7N4P5J0 | 20-178 | None |
| A0A835Y4Y1 | 3-153 | None |
| A0A653BZ17 | 9-184 | None |
| A0A6J0JA06 | 20-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.