DPCstruct | MC40950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 311 ± 51 aa |
| Standard deviation of domain lengths | 50.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.85 |
| Pfam Score | 46.67 |
| Assigned Pfam label(s) | CL0537- PF05295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813BNN0 | 7-353 | AWRSELIDRQVPQQVLAFFENEGIVSASRLANYVDTRDEIMTLIVDKIPELNGSRSVKALLTEIWREADHSESLRLQRKAAGCRDDD… |
| A0A812T6W0 | 3-284 | ASYSDSQSVFNARVDASGLTKEDATKIKAAVSSLRQLAFISSFTPGQADESPLMAALKLMLGRDAELGVQASFRALYHESYAVVTSE… |
| A0A812YPA7 | 5-260 | None |
| A0A812ZRZ7 | 20-278 | None |
| A0A813ABP5 | 2-277 | None |
| A0A813ACE8 | 348-573 | None |
| A0A813AVZ8 | 1-261 | None |
| A0A813AZD4 | 6-284 | None |
| A0A813B2G7 | 134-502 | None |
| A0A813B9M5 | 1-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.