DPCstruct | MC4095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 170 ± 22 aa |
| Standard deviation of domain lengths | 21.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8JBC9 | 27-200 | NLHPDIRLVNDHVKRYPKIQVQDVYKLLYQGEFGVKHIIDNPEAARAYLDKELEQSAADSSEPLWEYISSDSTMVRIHLRPFNAGHY… |
| A0A7Y5FH47 | 57-233 | QAARIEQAVREELRLHPAATLQDLYKFFFQGAYGPGHMIPDAAAARRFLAMELHASTDFDSVLWQPVGVHGEYVRVNLKLVKEGIIP… |
| A0A662FDL7 | 8-197 | None |
| A0A7C3F3U2 | 33-205 | None |
| A0A2N0B517 | 13-196 | None |
| A0A7X8GQT9 | 80-247 | None |
| A0A1H8CHD3 | 22-200 | None |
| A0A662QIJ0 | 30-213 | None |
| A0A7C6Y343 | 5-179 | None |
| A0A644XNY5 | 2-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.