DPCstruct | MC40948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 244 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 66.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9CYK0 | 21-260 | FLVCENMAWSRDRDWNQSSWKTSSSWDKTTSSGWNNRDWQRDQPSVPSPSVSIPSTFVSDWECYDTNVVSNKKFFRNIQSTSWSTKS… |
| A0A812YDI9 | 2-236 | ASWSSWSNSDSSNSWDNRQQWNRWSKEDKWDSKYSEKSWECVASPTYQSFSLPSSFVSDQQHYDKTPLGKGAHVLHKLVQPTEWSRK… |
| A0A813ANQ9 | 170-438 | None |
| A0A812MWQ2 | 241-504 | None |
| A0A1Q9CPI0 | 1-244 | None |
| A0A812LVW0 | 1-248 | None |
| A0A812QI80 | 25-258 | None |
| A0A812UHZ7 | 1-227 | None |
| A0A812SLA4 | 3-245 | None |
| A0A812NDA7 | 1-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.