DPCstruct | MC40946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 496 ± 83 aa |
| Standard deviation of domain lengths | 82.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813AZA5 | 39-540 | QTQTLRPSQVLCHPSNRGGQMVSHFDVWQKGHQLLGVGLQVQLLEHSICIQLATDPQKRQQQIWKNQQLVQEAGGSLAPVTGQEGFL… |
| A0A812JRX9 | 2-367 | QECMDYMLSTGLAWRQRLQCECIGIHEQNRDGLGVSAGHVSELLSSILALGFVESECRGVCIELTSDSSSERTRLFNVRLAEESKGR… |
| A0A1Q9EMQ7 | 402-958 | None |
| A0A813B1T0 | 3-397 | None |
| A0A813BX25 | 3-438 | None |
| A0A1Q9C6K3 | 309-737 | None |
| A0A812R4N5 | 1-476 | None |
| A0A812QHX8 | 3-460 | None |
| A0A812IBM9 | 374-909 | None |
| A0A812LG87 | 1-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.