DPCstruct | MC40943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 243 ± 35 aa |
| Standard deviation of domain lengths | 35.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813AKY2 | 1-247 | MYLNSPRGSNNKLREQSNNVQNANRLFDSQNNAASGYQIGDDCKPACKDENNNYDVTKEGATKGTMKFYQGSELYIDWFVQHGCGVG… |
| A0A6S7KUR8 | 6-217 | RIFLLLATVQADMYLHNPRGSNNRLDEAKRERNNANRLFDSQNNNRGGYNVGSLYYYQESMLSVEWTNQHSCGDQNTHCEIILQYMC… |
| A0A815FJX4 | 108-271 | None |
| A0A7M5X391 | 6-246 | None |
| A0A7S4HTS0 | 8-263 | None |
| A0A820AZB0 | 1-177 | None |
| A0A7M5UVX7 | 1-293 | None |
| A0A2B4SMY6 | 360-656 | None |
| A0A6B2KZZ5 | 4-239 | None |
| A0A6J8E1U2 | 17-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.