DPCstruct | MC4094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 20 aa |
| Standard deviation of domain lengths | 19.84 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0QNX1 | 206-280 | ERVYAVTTANELVSFDANSAQTILTRSAIANLNAGERIVGIDFRPANNRLYALGSSSQLYLVDPRTGAAARVGAP |
| A0A7Y5CTR8 | 1-126 | MVRWGIAMLALLAVACEEQVMQPQVKGRPLYAVDSGNNLIRFGSLSPDTVSSKALSGLQPGEVILGIDFRPVDGRLYGISNLSRVYT… |
| A0A7K2XA02 | 1-130 | None |
| D8FUA2 | 199-289 | None |
| A0A838DB58 | 1-74 | None |
| L0DQ09 | 296-374 | None |
| A0A4Q5S8D3 | 13-136 | None |
| A0A7W0UZT9 | 1-73 | None |
| A0A812JG15 | 7-85 | None |
| A0A521N9I0 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.