DPCstruct | MC40938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 250 ± 50 aa |
| Standard deviation of domain lengths | 49.63 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0125- PF00330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812YJF2 | 843-1093 | VPGRVHRQEEAKANWSSNGGWGRGQWQRNWGRQAQQPSRNNRDGHEDQHAIVGLDLDFMFFLQSSKSGNSRSVTDALFKTAQDWDRQ… |
| A0A1Q9CUQ8 | 39-272 | DRDRDEEMETLREMIRHLARLALRLEDAMSICNLDNEFLMFFQTNSQWAVTSQLFKAATEWKEQKESAPQSLTQPLRSVLFYCVWTS… |
| A0A1Q9EQJ8 | 984-1270 | None |
| A0A813ADQ6 | 44-303 | None |
| A0A812LI07 | 119-397 | None |
| A0A812LPY0 | 639-928 | None |
| A0A812MND3 | 16-282 | None |
| A0A813ABJ7 | 209-430 | None |
| A0A813ADW2 | 2-136 | None |
| A0A1Q9C986 | 122-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.