DPCstruct | MC40935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 223 ± 59 aa |
| Standard deviation of domain lengths | 58.75 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812XYL1 | 35-269 | RKIDGIMMDLGVSSPQLDDRARGFSVTQDADLDLRMNQDVGIPAWQWLRQTSMEEIAWVIREYGEDGDPIISDRIAYAIKTRLASGL… |
| A0A1Q6UY29 | 60-222 | MQIDNPERGFSYKFDGPLDLRLDPQKGVPASERLREMSRDEIAGMLIENADEPYAEEIAKAISIQQKKKPIRTTTDLREVIEKALTF… |
| A0A7S1ZM29 | 301-556 | None |
| A0A1Q9CMB5 | 78-372 | None |
| A0A6A6KTI8 | 13-216 | None |
| A0A0R3UC94 | 15-225 | None |
| T0E4X5 | 5-233 | None |
| A0A7T9I270 | 66-338 | None |
| A0A348PH82 | 3-180 | None |
| A0A7S4E5K6 | 211-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.