DPCstruct | MC40934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6EZ00 | 72-187 | REIEIVRIFEDGPWVFCSAYQSLNDGAARWVTMDMFFTDAKGLILEHWDTIAPYVAETKSGEDMVGGPSDVNMSVDTAASKSLVLEY… |
| D2UD73 | 1-149 | MLQALPKGSTKVHTARVFQDGDHVFPHTEYDFFGPKIGSDIFHFVNGKIIKHGDNLQAKPTTRTPSGRSVIDEPTTAEDLDKTQANK… |
| A0A3L8RDJ1 | 280-409 | None |
| A0A328EGT5 | 13-155 | None |
| A0A2X4U6Z3 | 39-187 | None |
| B9NM20 | 2-119 | None |
| W6K733 | 41-188 | None |
| A0A090R9V2 | 64-220 | None |
| A0A1H7UQK8 | 268-413 | None |
| A0A1W0WUE6 | 323-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.