DPCstruct | MC40930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 228 ± 47 aa |
| Standard deviation of domain lengths | 47.34 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A133P455 | 3-209 | EKLKTLNKEEADELYEQYLESNNTIEDTSENFTDEEWKIANKFLNKYDLELWYLARGTCIIKEVPDFYYKTFKDYVTDDYKEYLKIT… |
| A0A0F5RAI7 | 4-152 | PEIDYVSYEAYKSHVGADIAAYIAMMSLETSKPTLRDAAIIIGWGELLQRNLAQEKFLRSYPSSNRKAKVESMYHLTKWNVFYGSNN… |
| D6BFF5 | 51-292 | None |
| A0A7X9BFT1 | 16-254 | None |
| A0A6N7Y0J9 | 238-499 | None |
| A0A1R0YIV9 | 2-134 | None |
| A0A3S9H2K8 | 39-304 | None |
| A0A2V7GXY1 | 6-168 | None |
| A0A1Y4CZC4 | 157-402 | None |
| A0A5B0BRK9 | 167-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.