DPCstruct | MC4093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 174 ± 29 aa |
| Standard deviation of domain lengths | 29.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2RJL7 | 15-185 | RKNNIGTFQVGMMKAPSADPLCCLGSCLCPCCAQIIIRRKALHYDMSNYTCCQGYMDGTLPCVRSGKCGESSCPNGCLCLEAFCCNG… |
| A0A5E4FVT5 | 13-175 | RQNYRNLWHSDLMSTIQADTPYCCFAAFCAPCASYLLRKRALYNDMSRYVCCAGYMPCSGRCGESKCPEFCLATEVFLCFGNSVAST… |
| A0A5D2KAP1 | 6-188 | None |
| A0A7J8LNT6 | 106-229 | None |
| A0A6G1EZA6 | 1-133 | None |
| A0A7S2KNR4 | 3-206 | None |
| A0A4S4D3K1 | 224-427 | None |
| C5WUF0 | 19-189 | None |
| A0A0D9XLW2 | 14-209 | None |
| A0A5B8MQJ2 | 24-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.