DPCstruct | MC40926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 136 ± 24 aa |
| Standard deviation of domain lengths | 24.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S5ECY2 | 6-110 | CAPASDVTTFMVSAGLTKDGYTLTNGTVIEDGGLTFFGATTVDSDGKMKNRSDVWVIKDGIVYASSGGARNGTSFSNAKDAPLKVLA… |
| A0A6B0ZKH9 | 1-133 | MSMSPTRTLPAAAIIALVAPFLAACAGPSIDVSGCDVALTATMETLQAGLTEDGTLRHGRTHERTDDQFFISAEFLPSDKDEDFDGD… |
| A0A7G6YYL3 | 1-186 | None |
| A0A379JGY0 | 47-183 | None |
| A0A1X0C3J9 | 15-131 | None |
| A0A097IJ64 | 1-92 | None |
| C3JL83 | 6-123 | None |
| A0A7L8D556 | 108-234 | None |
| A0A7Y9ZXW0 | 26-204 | None |
| A0A3G8VER6 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.