DPCstruct | MC40924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 222 ± 36 aa |
| Standard deviation of domain lengths | 36.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A431IQJ8 | 1-175 | MFDTTDFGYQRITVERPLRLRYRVGDGTLDEIQAAKAWAKLTDDERAAVTRALDPVHGLDTTDRDVAAKHLTEHGPVPKPIDKAVWT… |
| A0A2S6HL89 | 18-299 | FDNSDFGYYKVNIERPDRRKAQFSAERIETLRFDKSLREPMQWIYSQWGEIVYQPGTLDEREKAILVWCDENELNLNTKNRQKLLSP… |
| A0A533B3J2 | 2-258 | None |
| A0A367QG95 | 49-245 | None |
| A0A1H1PED9 | 1-205 | None |
| A0A4V2S3V5 | 415-605 | None |
| A0A832H1V8 | 1-282 | None |
| A0A7Y0RR10 | 17-239 | None |
| M0N3F9 | 12-235 | None |
| A0A1T4WBJ5 | 986-1247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.